PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 352aa    MW: 40028.4 Da    PI: 5.0279
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0770genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W+++Ed++l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
      Gh_A01G0770 16 RGPWSPQEDLRLITFIQKHGHENWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding50.35.4e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e ++++++ lG++ W++Ia+++  gRt++++k+ w+++l
      Gh_A01G0770  69 RGNFSKEEEETIIRLHETLGNK-WSKIASHLA-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-23766IPR009057Homeodomain-like
PROSITE profilePS5129415.3461163IPR017930Myb domain
SuperFamilySSF466898.24E-2914110IPR009057Homeodomain-like
SMARTSM007174.4E-131565IPR001005SANT/Myb domain
PfamPF002492.2E-151663IPR001005SANT/Myb domain
CDDcd001672.97E-91863No hitNo description
PROSITE profilePS5129424.88864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2667118IPR009057Homeodomain-like
SMARTSM007173.4E-1568116IPR001005SANT/Myb domain
PfamPF002498.3E-1569114IPR001005SANT/Myb domain
CDDcd001672.42E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGKGRAPCCD KDKVKRGPWS PQEDLRLITF IQKHGHENWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDVKRG NFSKEEEETI IRLHETLGNK WSKIASHLAG RTDNEIKNVW NTHLKKRLAP  120
KNGKIPQNDQ SKETCMVSSS CSSITFVSSP CGKRNLEVEL EQQWHEGSPS KKPREGFPVS  180
DKAEDFKTEV PSHNSGPFEE PKEFPSSSIS SSNSNITNSS QVNVPNPENH GDSLLNFIGV  240
YDWENNTSEE VNKPEILNNA FDIPLESDSD FWDMLDSLGS FQPDEIQSNE VEGNQSPDFG  300
EEYSKENENN KWLQYLEIEL GLEVTKNENH NNLSNTAAEP LVPEMYDMLL KP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-24161184105MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-241611858159MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-241611858159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-24161184105C-Myb DNA-Binding Domain
1msf_C2e-24161184105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591394e-58AJ459139.1 Gossypium hirsutum partial myb113 gene, clone pGhMYB113.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012462848.10.0PREDICTED: myb-related protein 305-like
TrEMBLA0A0B0NJ990.0A0A0B0NJ99_G
STRINGPOPTR_0005s09930.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.15e-76myb domain protein 72